Placeholder image of a protein
Icon representing a puzzle

1919: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,848
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,837
  3. Avatar for Go Science 3. Go Science 54 pts. 9,743
  4. Avatar for Contenders 4. Contenders 38 pts. 9,697
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,694
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 9,676
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 9,667
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,605
  9. Avatar for Team China 9. Team China 5 pts. 9,303
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 9,295
  1. Avatar for dcrwheeler 21. dcrwheeler Lv 1 53 pts. 9,652
  2. Avatar for KarenCH 22. KarenCH Lv 1 51 pts. 9,649
  3. Avatar for fiendish_ghoul 23. fiendish_ghoul Lv 1 49 pts. 9,647
  4. Avatar for g_b 24. g_b Lv 1 48 pts. 9,642
  5. Avatar for drjr 25. drjr Lv 1 46 pts. 9,630
  6. Avatar for martin.kendig@verizon.net 26. martin.kendig@verizon.net Lv 1 44 pts. 9,623
  7. Avatar for Timo van der Laan 27. Timo van der Laan Lv 1 43 pts. 9,605
  8. Avatar for BootsMcGraw 28. BootsMcGraw Lv 1 41 pts. 9,601
  9. Avatar for silent gene 29. silent gene Lv 1 40 pts. 9,598
  10. Avatar for Galaxie 30. Galaxie Lv 1 39 pts. 9,586

Comments