Placeholder image of a protein
Icon representing a puzzle

1919: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,206
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 9,060
  3. Avatar for Gruppo notte dei ricercatori 13. Gruppo notte dei ricercatori 1 pt. 9,059
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 8,958
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,562
  6. Avatar for Window Group 16. Window Group 1 pt. 8,520
  7. Avatar for Fox Folds 17. Fox Folds 1 pt. 8,277
  8. Avatar for Biochimica generale - Medicina RA 18. Biochimica generale - Medicina RA 1 pt. 8,277
  1. Avatar for johnmitch 31. johnmitch Lv 1 37 pts. 9,583
  2. Avatar for Formula350 32. Formula350 Lv 1 36 pts. 9,577
  3. Avatar for maithra 33. maithra Lv 1 35 pts. 9,571
  4. Avatar for nicobul 34. nicobul Lv 1 33 pts. 9,570
  5. Avatar for Aubade01 35. Aubade01 Lv 1 32 pts. 9,570
  6. Avatar for WBarme1234 36. WBarme1234 Lv 1 31 pts. 9,563
  7. Avatar for OWM3 37. OWM3 Lv 1 30 pts. 9,555
  8. Avatar for Blipperman 38. Blipperman Lv 1 29 pts. 9,555
  9. Avatar for Threeoak 39. Threeoak Lv 1 28 pts. 9,539
  10. Avatar for ucad 40. ucad Lv 1 26 pts. 9,535

Comments