Placeholder image of a protein
Icon representing a puzzle

1919: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,848
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,837
  3. Avatar for Go Science 3. Go Science 54 pts. 9,743
  4. Avatar for Contenders 4. Contenders 38 pts. 9,697
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,694
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 9,676
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 9,667
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,605
  9. Avatar for Team China 9. Team China 5 pts. 9,303
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 9,295
  1. Avatar for johnmitch 31. johnmitch Lv 1 37 pts. 9,583
  2. Avatar for Formula350 32. Formula350 Lv 1 36 pts. 9,577
  3. Avatar for maithra 33. maithra Lv 1 35 pts. 9,571
  4. Avatar for nicobul 34. nicobul Lv 1 33 pts. 9,570
  5. Avatar for Aubade01 35. Aubade01 Lv 1 32 pts. 9,570
  6. Avatar for WBarme1234 36. WBarme1234 Lv 1 31 pts. 9,563
  7. Avatar for OWM3 37. OWM3 Lv 1 30 pts. 9,555
  8. Avatar for Blipperman 38. Blipperman Lv 1 29 pts. 9,555
  9. Avatar for Threeoak 39. Threeoak Lv 1 28 pts. 9,539
  10. Avatar for ucad 40. ucad Lv 1 26 pts. 9,535

Comments