Placeholder image of a protein
Icon representing a puzzle

1919: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,848
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,837
  3. Avatar for Go Science 3. Go Science 54 pts. 9,743
  4. Avatar for Contenders 4. Contenders 38 pts. 9,697
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,694
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 9,676
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 9,667
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,605
  9. Avatar for Team China 9. Team China 5 pts. 9,303
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 9,295
  1. Avatar for 15SecNut 151. 15SecNut Lv 1 1 pt. 8,576
  2. Avatar for aspadistra 152. aspadistra Lv 1 1 pt. 8,562
  3. Avatar for chen20 153. chen20 Lv 1 1 pt. 8,561
  4. Avatar for Laura6801 154. Laura6801 Lv 1 1 pt. 8,556
  5. Avatar for rezaefar 155. rezaefar Lv 1 1 pt. 8,522
  6. Avatar for jflat06 156. jflat06 Lv 1 1 pt. 8,520
  7. Avatar for devjosh 157. devjosh Lv 1 1 pt. 8,277
  8. Avatar for emluu 158. emluu Lv 1 1 pt. 8,277
  9. Avatar for Bletchley Park 159. Bletchley Park Lv 1 1 pt. 8,277
  10. Avatar for uu_mia 160. uu_mia Lv 1 1 pt. 8,277

Comments