Placeholder image of a protein
Icon representing a puzzle

1919: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,848
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,837
  3. Avatar for Go Science 3. Go Science 54 pts. 9,743
  4. Avatar for Contenders 4. Contenders 38 pts. 9,697
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,694
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 9,676
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 9,667
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,605
  9. Avatar for Team China 9. Team China 5 pts. 9,303
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 9,295
  1. Avatar for ramon.bruelisauer 121. ramon.bruelisauer Lv 1 1 pt. 9,104
  2. Avatar for multaq 122. multaq Lv 1 1 pt. 9,094
  3. Avatar for mike2347 123. mike2347 Lv 1 1 pt. 9,069
  4. Avatar for fabiodavilla 124. fabiodavilla Lv 1 1 pt. 9,065
  5. Avatar for joshmiller 125. joshmiller Lv 1 1 pt. 9,060
  6. Avatar for alessandro_f 126. alessandro_f Lv 1 1 pt. 9,059
  7. Avatar for tracybutt 127. tracybutt Lv 1 1 pt. 9,053
  8. Avatar for Wonwoo Park 128. Wonwoo Park Lv 1 1 pt. 9,042
  9. Avatar for Jenot96 129. Jenot96 Lv 1 1 pt. 9,042
  10. Avatar for LukeBoxWalker 130. LukeBoxWalker Lv 1 1 pt. 9,036

Comments