Placeholder image of a protein
Icon representing a puzzle

1922: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 25, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 10,730
  2. Avatar for Russian team 12. Russian team 1 pt. 10,630
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,468
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,292
  5. Avatar for Team China 15. Team China 1 pt. 10,232
  6. Avatar for Fox Folds 16. Fox Folds 1 pt. 10,087
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,759
  1. Avatar for Ibragimov Rashid Aydamirovich 161. Ibragimov Rashid Aydamirovich Lv 1 1 pt. 9,334
  2. Avatar for IronDinosaur 162. IronDinosaur Lv 1 1 pt. 9,314
  3. Avatar for winterkonig 163. winterkonig Lv 1 1 pt. 9,218
  4. Avatar for Study2020 164. Study2020 Lv 1 1 pt. 8,796
  5. Avatar for devjosh 165. devjosh Lv 1 1 pt. 8,759
  6. Avatar for gh68 166. gh68 Lv 1 1 pt. 8,704
  7. Avatar for bkoep 167. bkoep Lv 1 1 pt. 8,656
  8. Avatar for 2018113392 168. 2018113392 Lv 1 1 pt. 8,656
  9. Avatar for gabb 169. gabb Lv 1 1 pt. 8,656
  10. Avatar for Wonwoo Park 170. Wonwoo Park Lv 1 1 pt. 8,656

Comments