Placeholder image of a protein
Icon representing a puzzle

1922: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 25, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Go Science 100 pts. 12,030
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 12,009
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,976
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 11,974
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 11,927
  6. Avatar for Contenders 6. Contenders 16 pts. 11,926
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,831
  8. Avatar for Hold My Beer 8. Hold My Beer 6 pts. 11,785
  9. Avatar for Void Crushers 9. Void Crushers 4 pts. 10,973
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 10,776

  1. Avatar for IronDinosaur 162. IronDinosaur Lv 1 1 pt. 9,314
  2. Avatar for winterkonig 163. winterkonig Lv 1 1 pt. 9,218
  3. Avatar for Study2020 164. Study2020 Lv 1 1 pt. 8,796
  4. Avatar for devjosh 165. devjosh Lv 1 1 pt. 8,759
  5. Avatar for gh68 166. gh68 Lv 1 1 pt. 8,704
  6. Avatar for bkoep 167. bkoep Lv 1 1 pt. 8,656
  7. Avatar for Wonwoo Park 168. Wonwoo Park Lv 1 1 pt. 8,656
  8. Avatar for tym0perm 169. tym0perm Lv 1 1 pt. 8,656
  9. Avatar for 2018113392 170. 2018113392 Lv 1 1 pt. 8,656

Comments