Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,813
  2. Avatar for Deleted group 12. Deleted group pts. 10,781
  3. Avatar for Team China 13. Team China 1 pt. 10,661
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,491
  5. Avatar for Fox Folds 15. Fox Folds 1 pt. 10,275
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 10,180
  1. Avatar for Savas 101. Savas Lv 1 1 pt. 10,491
  2. Avatar for kaceytier 102. kaceytier Lv 1 1 pt. 10,485
  3. Avatar for prooh 103. prooh Lv 1 1 pt. 10,469
  4. Avatar for Altercomp 104. Altercomp Lv 1 1 pt. 10,452
  5. Avatar for cgraph 105. cgraph Lv 1 1 pt. 10,416
  6. Avatar for pfirth 106. pfirth Lv 1 1 pt. 10,395
  7. Avatar for Arne Heessels 107. Arne Heessels Lv 1 1 pt. 10,390
  8. Avatar for rinze 108. rinze Lv 1 1 pt. 10,382
  9. Avatar for ivalnic 109. ivalnic Lv 1 1 pt. 10,360
  10. Avatar for Jumper2 110. Jumper2 Lv 1 1 pt. 10,354

Comments