Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,602
  2. Avatar for Gargleblasters 2. Gargleblasters 71 pts. 11,587
  3. Avatar for Go Science 3. Go Science 49 pts. 11,584
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 11,528
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,416
  6. Avatar for Contenders 6. Contenders 14 pts. 11,275
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,203
  8. Avatar for Russian team 8. Russian team 5 pts. 11,095
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 3 pts. 10,886
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,854
  1. Avatar for Savas 101. Savas Lv 1 1 pt. 10,491
  2. Avatar for kaceytier 102. kaceytier Lv 1 1 pt. 10,485
  3. Avatar for prooh 103. prooh Lv 1 1 pt. 10,469
  4. Avatar for Altercomp 104. Altercomp Lv 1 1 pt. 10,452
  5. Avatar for cgraph 105. cgraph Lv 1 1 pt. 10,416
  6. Avatar for pfirth 106. pfirth Lv 1 1 pt. 10,395
  7. Avatar for Arne Heessels 107. Arne Heessels Lv 1 1 pt. 10,390
  8. Avatar for rinze 108. rinze Lv 1 1 pt. 10,382
  9. Avatar for ivalnic 109. ivalnic Lv 1 1 pt. 10,360
  10. Avatar for Jumper2 110. Jumper2 Lv 1 1 pt. 10,354

Comments