Placeholder image of a protein
Icon representing a puzzle

1928: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 10, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 11,205
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 11,016
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,944
  4. Avatar for Fox Folds 14. Fox Folds 1 pt. 10,944
  5. Avatar for Deleted group 15. Deleted group pts. 10,867
  6. Avatar for MAB_STEM 16. MAB_STEM 1 pt. 10,846
  7. Avatar for Hold My Beer 17. Hold My Beer 1 pt. 10,786
  8. Avatar for Window Group 18. Window Group 1 pt. 8,991
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 8,975
  1. Avatar for ArcherTitou 151. ArcherTitou Lv 1 1 pt. 8,949
  2. Avatar for BPS_Giannetti_2020 152. BPS_Giannetti_2020 Lv 1 1 pt. 8,949
  3. Avatar for Anastase 153. Anastase Lv 1 1 pt. 8,949
  4. Avatar for Qizhou_Huang 154. Qizhou_Huang Lv 1 1 pt. 8,949
  5. Avatar for MarkSmith 155. MarkSmith Lv 1 1 pt. 8,949
  6. Avatar for Keresto 156. Keresto Lv 1 1 pt. 8,949
  7. Avatar for bkoep 157. bkoep Lv 1 1 pt. 8,949
  8. Avatar for artara 158. artara Lv 1 1 pt. 8,949
  9. Avatar for Dmitriy_Egorov 159. Dmitriy_Egorov Lv 1 1 pt. 8,949
  10. Avatar for Study2020 160. Study2020 Lv 1 1 pt. 8,949

Comments