Placeholder image of a protein
Icon representing a puzzle

1928: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
December 10, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 11,205
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 11,016
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,944
  4. Avatar for Fox Folds 14. Fox Folds 1 pt. 10,944
  5. Avatar for Deleted group 15. Deleted group pts. 10,867
  6. Avatar for MAB_STEM 16. MAB_STEM 1 pt. 10,846
  7. Avatar for Hold My Beer 17. Hold My Beer 1 pt. 10,786
  8. Avatar for Window Group 18. Window Group 1 pt. 8,991
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 8,975
  1. Avatar for Phyx 21. Phyx Lv 1 52 pts. 11,946
  2. Avatar for robgee 22. robgee Lv 1 50 pts. 11,940
  3. Avatar for ucad 23. ucad Lv 1 48 pts. 11,928
  4. Avatar for TurtleByte 24. TurtleByte Lv 1 47 pts. 11,927
  5. Avatar for NinjaGreg 25. NinjaGreg Lv 1 45 pts. 11,917
  6. Avatar for fiendish_ghoul 26. fiendish_ghoul Lv 1 43 pts. 11,913
  7. Avatar for g_b 27. g_b Lv 1 42 pts. 11,902
  8. Avatar for akaaka 28. akaaka Lv 1 40 pts. 11,888
  9. Avatar for johnmitch 29. johnmitch Lv 1 39 pts. 11,886
  10. Avatar for Blipperman 30. Blipperman Lv 1 37 pts. 11,886

Comments