Placeholder image of a protein
Icon representing a puzzle

1928: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
December 10, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 12,397
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 12,186
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 12,133
  4. Avatar for Go Science 4. Go Science 41 pts. 12,104
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 12,054
  6. Avatar for Contenders 6. Contenders 20 pts. 11,838
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 11,732
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 11,589
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 6 pts. 11,273
  10. Avatar for Team China 10. Team China 4 pts. 11,228
  1. Avatar for Phyx 21. Phyx Lv 1 52 pts. 11,946
  2. Avatar for robgee 22. robgee Lv 1 50 pts. 11,940
  3. Avatar for ucad 23. ucad Lv 1 48 pts. 11,928
  4. Avatar for TurtleByte 24. TurtleByte Lv 1 47 pts. 11,927
  5. Avatar for NinjaGreg 25. NinjaGreg Lv 1 45 pts. 11,917
  6. Avatar for fiendish_ghoul 26. fiendish_ghoul Lv 1 43 pts. 11,913
  7. Avatar for g_b 27. g_b Lv 1 42 pts. 11,902
  8. Avatar for akaaka 28. akaaka Lv 1 40 pts. 11,888
  9. Avatar for johnmitch 29. johnmitch Lv 1 39 pts. 11,886
  10. Avatar for Blipperman 30. Blipperman Lv 1 37 pts. 11,886

Comments