Placeholder image of a protein
Icon representing a puzzle

1928: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
December 10, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 12,397
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 12,186
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 12,133
  4. Avatar for Go Science 4. Go Science 41 pts. 12,104
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 12,054
  6. Avatar for Contenders 6. Contenders 20 pts. 11,838
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 11,732
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 11,589
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 6 pts. 11,273
  10. Avatar for Team China 10. Team China 4 pts. 11,228
  1. Avatar for manu8170 61. manu8170 Lv 1 10 pts. 11,471
  2. Avatar for borattt 62. borattt Lv 1 10 pts. 11,470
  3. Avatar for stomjoh 63. stomjoh Lv 1 9 pts. 11,460
  4. Avatar for rezaefar 64. rezaefar Lv 1 9 pts. 11,455
  5. Avatar for abiogenesis 65. abiogenesis Lv 1 8 pts. 11,442
  6. Avatar for fearjuan 66. fearjuan Lv 1 8 pts. 11,435
  7. Avatar for Czim 67. Czim Lv 1 7 pts. 11,433
  8. Avatar for Hanto 68. Hanto Lv 1 7 pts. 11,424
  9. Avatar for Dhalion 69. Dhalion Lv 1 7 pts. 11,421
  10. Avatar for Pawel Tluscik 70. Pawel Tluscik Lv 1 6 pts. 11,407

Comments