Placeholder image of a protein
Icon representing a puzzle

1928: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
December 10, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 12,397
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 12,186
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 12,133
  4. Avatar for Go Science 4. Go Science 41 pts. 12,104
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 12,054
  6. Avatar for Contenders 6. Contenders 20 pts. 11,838
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 11,732
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 11,589
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 6 pts. 11,273
  10. Avatar for Team China 10. Team China 4 pts. 11,228
  1. Avatar for OWM3 81. OWM3 Lv 1 4 pts. 11,305
  2. Avatar for JasperD 82. JasperD Lv 1 3 pts. 11,273
  3. Avatar for micon 83. micon Lv 1 3 pts. 11,253
  4. Avatar for alwen 84. alwen Lv 1 3 pts. 11,242
  5. Avatar for CAN1958 85. CAN1958 Lv 1 3 pts. 11,233
  6. Avatar for FredFromTmm 86. FredFromTmm Lv 1 3 pts. 11,233
  7. Avatar for zo3xiaJonWeinberg 87. zo3xiaJonWeinberg Lv 1 3 pts. 11,228
  8. Avatar for MrZanav 88. MrZanav Lv 1 2 pts. 11,223
  9. Avatar for infjamc 89. infjamc Lv 1 2 pts. 11,222
  10. Avatar for ShadowTactics 90. ShadowTactics Lv 1 2 pts. 11,205

Comments