Placeholder image of a protein
Icon representing a puzzle

1934: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 23, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 10,339

  1. Avatar for AlkiP0Ps 101. AlkiP0Ps Lv 1 1 pt. 10,339
  2. Avatar for fabiodavilla 102. fabiodavilla Lv 1 1 pt. 10,292
  3. Avatar for Squirrely 103. Squirrely Lv 1 1 pt. 10,286
  4. Avatar for pruneau_44 104. pruneau_44 Lv 1 1 pt. 10,272
  5. Avatar for FWishbringer 105. FWishbringer Lv 1 1 pt. 10,264
  6. Avatar for CatieKejti 106. CatieKejti Lv 1 1 pt. 10,251
  7. Avatar for JustinRothganger 107. JustinRothganger Lv 1 1 pt. 10,217
  8. Avatar for illex 108. illex Lv 1 1 pt. 10,186
  9. Avatar for Mesu123 109. Mesu123 Lv 1 1 pt. 10,185
  10. Avatar for Cicadashell 110. Cicadashell Lv 1 1 pt. 10,075

Comments