Placeholder image of a protein
Icon representing a puzzle

1937: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since over 5 years ago

Novice Novice Novice Novice Overall Overall Overall Overall Prediction Prediction Prediction Prediction

Summary


Created
December 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups


  1. Avatar for Beta Folders 100 pts. 11,622
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,611
  3. Avatar for Go Science 3. Go Science 47 pts. 11,581
  4. Avatar for Gargleblasters 4. Gargleblasters 30 pts. 11,434
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 11,411
  6. Avatar for Contenders 6. Contenders 11 pts. 11,363
  7. Avatar for Marvin's bunch 7. Marvin's bunch 7 pts. 11,299
  8. Avatar for SETI.Germany 8. SETI.Germany 4 pts. 10,422
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 2 pts. 10,353
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 10,146

  1. Avatar for Lotus23 21. Lotus23 Lv 1 47 pts. 11,331
  2. Avatar for BootsMcGraw 22. BootsMcGraw Lv 1 45 pts. 11,323
  3. Avatar for Deleted player 23. Deleted player 43 pts. 11,320
  4. Avatar for jausmh 24. jausmh Lv 1 41 pts. 11,290
  5. Avatar for fpc 25. fpc Lv 1 40 pts. 11,276
  6. Avatar for Galaxie 26. Galaxie Lv 1 38 pts. 11,275
  7. Avatar for Blipperman 27. Blipperman Lv 1 36 pts. 11,256
  8. Avatar for jobo0502 28. jobo0502 Lv 1 35 pts. 11,254
  9. Avatar for Combinatoria 29. Combinatoria Lv 1 33 pts. 11,237
  10. Avatar for guineapig 30. guineapig Lv 1 32 pts. 11,227

Comments