Placeholder image of a protein
Icon representing a puzzle

1937: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
December 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups


  1. Avatar for Beta Folders 100 pts. 11,622
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,611
  3. Avatar for Go Science 3. Go Science 47 pts. 11,581
  4. Avatar for Gargleblasters 4. Gargleblasters 30 pts. 11,434
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 11,411
  6. Avatar for Contenders 6. Contenders 11 pts. 11,363
  7. Avatar for Marvin's bunch 7. Marvin's bunch 7 pts. 11,299
  8. Avatar for SETI.Germany 8. SETI.Germany 4 pts. 10,422
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 2 pts. 10,353
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 10,146

  1. Avatar for Hanto 61. Hanto Lv 1 7 pts. 10,664
  2. Avatar for zackallen 62. zackallen Lv 1 6 pts. 10,652
  3. Avatar for jsfoldingaccount 63. jsfoldingaccount Lv 1 6 pts. 10,627
  4. Avatar for borattt 64. borattt Lv 1 6 pts. 10,611
  5. Avatar for Pawel Tluscik 65. Pawel Tluscik Lv 1 5 pts. 10,609
  6. Avatar for kevin everington 66. kevin everington Lv 1 5 pts. 10,608
  7. Avatar for phi16 67. phi16 Lv 1 5 pts. 10,596
  8. Avatar for zippyc137 68. zippyc137 Lv 1 4 pts. 10,586
  9. Avatar for Formula350 69. Formula350 Lv 1 4 pts. 10,584
  10. Avatar for Evica 70. Evica Lv 1 4 pts. 10,572

Comments