Placeholder image of a protein
Icon representing a puzzle

1940: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
January 06, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,281
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,150
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 10,039
  4. Avatar for Australia 14. Australia 1 pt. 9,961
  5. Avatar for Window Group 15. Window Group 1 pt. 8,548
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,139

  1. Avatar for Arne Heessels 101. Arne Heessels Lv 1 1 pt. 10,153
  2. Avatar for ShadowTactics 102. ShadowTactics Lv 1 1 pt. 10,150
  3. Avatar for Mohoernchen 103. Mohoernchen Lv 1 1 pt. 10,079
  4. Avatar for Jumper2 104. Jumper2 Lv 1 1 pt. 10,048
  5. Avatar for Tlaloc 105. Tlaloc Lv 1 1 pt. 10,039
  6. Avatar for dahast.de 106. dahast.de Lv 1 1 pt. 10,030
  7. Avatar for Beany 107. Beany Lv 1 1 pt. 10,009
  8. Avatar for Sammy3c2b1a0 108. Sammy3c2b1a0 Lv 1 1 pt. 9,977
  9. Avatar for AlkiP0Ps 109. AlkiP0Ps Lv 1 1 pt. 9,961
  10. Avatar for pfirth 110. pfirth Lv 1 1 pt. 9,944

Comments