Placeholder image of a protein
Icon representing a puzzle

1940: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
January 06, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,281
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,150
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 10,039
  4. Avatar for Australia 14. Australia 1 pt. 9,961
  5. Avatar for Window Group 15. Window Group 1 pt. 8,548
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,139
  1. Avatar for BLU2117 111. BLU2117 Lv 1 1 pt. 9,944
  2. Avatar for Dr.Sillem 112. Dr.Sillem Lv 1 1 pt. 9,939
  3. Avatar for heyubob 113. heyubob Lv 1 1 pt. 9,938
  4. Avatar for lachlanASA 114. lachlanASA Lv 1 1 pt. 9,914
  5. Avatar for fabiodavilla 115. fabiodavilla Lv 1 1 pt. 9,879
  6. Avatar for kludbrook 116. kludbrook Lv 1 1 pt. 9,869
  7. Avatar for artsycook 117. artsycook Lv 1 1 pt. 9,848
  8. Avatar for zannipietro 118. zannipietro Lv 1 1 pt. 9,846
  9. Avatar for laiim 119. laiim Lv 1 1 pt. 9,823
  10. Avatar for mrsthursday1 120. mrsthursday1 Lv 1 1 pt. 9,821

Comments