Placeholder image of a protein
Icon representing a puzzle

1940: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
January 06, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,281
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,150
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 10,039
  4. Avatar for Australia 14. Australia 1 pt. 9,961
  5. Avatar for Window Group 15. Window Group 1 pt. 8,548
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,139

  1. Avatar for Yuriy3011 121. Yuriy3011 Lv 1 1 pt. 9,809
  2. Avatar for Deet 122. Deet Lv 1 1 pt. 9,807
  3. Avatar for Altercomp 123. Altercomp Lv 1 1 pt. 9,804
  4. Avatar for RenataASA 124. RenataASA Lv 1 1 pt. 9,794
  5. Avatar for jurep 125. jurep Lv 1 1 pt. 9,787
  6. Avatar for jgreene305 126. jgreene305 Lv 1 1 pt. 9,778
  7. Avatar for Axolotlprime 127. Axolotlprime Lv 1 1 pt. 9,758
  8. Avatar for LELE1964 128. LELE1964 Lv 1 1 pt. 9,748
  9. Avatar for frostschutz 129. frostschutz Lv 1 1 pt. 9,748
  10. Avatar for Larini 130. Larini Lv 1 1 pt. 9,743

Comments