Placeholder image of a protein
Icon representing a puzzle

1940: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 06, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,281
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,150
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 10,039
  4. Avatar for Australia 14. Australia 1 pt. 9,961
  5. Avatar for Window Group 15. Window Group 1 pt. 8,548
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,139
  1. Avatar for zo3xiaJonWeinberg 131. zo3xiaJonWeinberg Lv 1 1 pt. 9,735
  2. Avatar for SharksAreNice 132. SharksAreNice Lv 1 1 pt. 9,728
  3. Avatar for killthebat 133. killthebat Lv 1 1 pt. 9,717
  4. Avatar for androidkill 134. androidkill Lv 1 1 pt. 9,709
  5. Avatar for Sydefecks 135. Sydefecks Lv 1 1 pt. 9,700
  6. Avatar for RockOn 136. RockOn Lv 1 1 pt. 9,679
  7. Avatar for Pikkachurin 137. Pikkachurin Lv 1 1 pt. 9,656
  8. Avatar for reich64 138. reich64 Lv 1 1 pt. 9,627
  9. Avatar for omia 139. omia Lv 1 1 pt. 9,559
  10. Avatar for pascal ochem 140. pascal ochem Lv 1 1 pt. 9,354

Comments