Placeholder image of a protein
Icon representing a puzzle

1940: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 06, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,281
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,150
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 10,039
  4. Avatar for Australia 14. Australia 1 pt. 9,961
  5. Avatar for Window Group 15. Window Group 1 pt. 8,548
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,139
  1. Avatar for ivalnic 141. ivalnic Lv 1 1 pt. 9,326
  2. Avatar for Alivarx 142. Alivarx Lv 1 1 pt. 9,298
  3. Avatar for Jacob253 143. Jacob253 Lv 1 1 pt. 8,964
  4. Avatar for jflat06 144. jflat06 Lv 1 1 pt. 8,548
  5. Avatar for isilhocaoglu 145. isilhocaoglu Lv 1 1 pt. 8,237
  6. Avatar for vladikas 146. vladikas Lv 1 1 pt. 8,139
  7. Avatar for CuteKitten24 147. CuteKitten24 Lv 1 1 pt. 8,139
  8. Avatar for devjosh 148. devjosh Lv 1 1 pt. 8,139
  9. Avatar for LordOfDojo 149. LordOfDojo Lv 1 1 pt. 8,139
  10. Avatar for atiboy 150. atiboy Lv 1 1 pt. 8,139

Comments