Placeholder image of a protein
Icon representing a puzzle

1940: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 06, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,281
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,150
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 10,039
  4. Avatar for Australia 14. Australia 1 pt. 9,961
  5. Avatar for Window Group 15. Window Group 1 pt. 8,548
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,139
  1. Avatar for MicElephant 11. MicElephant Lv 1 71 pts. 11,437
  2. Avatar for ichwilldiesennamen 12. ichwilldiesennamen Lv 1 69 pts. 11,432
  3. Avatar for aznarog 13. aznarog Lv 1 66 pts. 11,414
  4. Avatar for Enzyme 14. Enzyme Lv 1 64 pts. 11,376
  5. Avatar for silent gene 15. silent gene Lv 1 62 pts. 11,363
  6. Avatar for robgee 16. robgee Lv 1 60 pts. 11,355
  7. Avatar for Galaxie 17. Galaxie Lv 1 57 pts. 11,331
  8. Avatar for BootsMcGraw 18. BootsMcGraw Lv 1 55 pts. 11,310
  9. Avatar for drjr 19. drjr Lv 1 53 pts. 11,282
  10. Avatar for Formula350 20. Formula350 Lv 1 51 pts. 11,278

Comments