Placeholder image of a protein
Icon representing a puzzle

1940: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
January 06, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,281
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,150
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 10,039
  4. Avatar for Australia 14. Australia 1 pt. 9,961
  5. Avatar for Window Group 15. Window Group 1 pt. 8,548
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,139

  1. Avatar for johnmitch 21. johnmitch Lv 1 49 pts. 11,277
  2. Avatar for jobo0502 22. jobo0502 Lv 1 48 pts. 11,268
  3. Avatar for jausmh 23. jausmh Lv 1 46 pts. 11,256
  4. Avatar for pauldunn 24. pauldunn Lv 1 44 pts. 11,226
  5. Avatar for Threeoak 25. Threeoak Lv 1 42 pts. 11,185
  6. Avatar for guineapig 26. guineapig Lv 1 41 pts. 11,165
  7. Avatar for GuR0 27. GuR0 Lv 1 39 pts. 11,162
  8. Avatar for fiendish_ghoul 28. fiendish_ghoul Lv 1 38 pts. 11,160
  9. Avatar for sgeldhof 29. sgeldhof Lv 1 36 pts. 11,149
  10. Avatar for NeLikomSheet 30. NeLikomSheet Lv 1 35 pts. 11,148

Comments