Placeholder image of a protein
Icon representing a puzzle

1940: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 06, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,281
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,150
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 10,039
  4. Avatar for Australia 14. Australia 1 pt. 9,961
  5. Avatar for Window Group 15. Window Group 1 pt. 8,548
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,139
  1. Avatar for Norrjane 31. Norrjane Lv 1 33 pts. 11,133
  2. Avatar for g_b 32. g_b Lv 1 32 pts. 11,130
  3. Avatar for NinjaGreg 33. NinjaGreg Lv 1 31 pts. 11,120
  4. Avatar for WBarme1234 34. WBarme1234 Lv 1 29 pts. 11,084
  5. Avatar for PieThrower 35. PieThrower Lv 1 28 pts. 11,062
  6. Avatar for akaaka 36. akaaka Lv 1 27 pts. 11,046
  7. Avatar for BarrySampson 37. BarrySampson Lv 1 26 pts. 11,027
  8. Avatar for John McLeod 38. John McLeod Lv 1 25 pts. 11,021
  9. Avatar for nicobul 39. nicobul Lv 1 24 pts. 11,021
  10. Avatar for Blipperman 40. Blipperman Lv 1 23 pts. 11,011

Comments