Placeholder image of a protein
Icon representing a puzzle

1940: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 06, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,281
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,150
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 10,039
  4. Avatar for Australia 14. Australia 1 pt. 9,961
  5. Avatar for Window Group 15. Window Group 1 pt. 8,548
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,139
  1. Avatar for ucad 41. ucad Lv 1 22 pts. 10,998
  2. Avatar for Lotus23 42. Lotus23 Lv 1 21 pts. 10,977
  3. Avatar for manu8170 43. manu8170 Lv 1 20 pts. 10,955
  4. Avatar for OWM3 44. OWM3 Lv 1 19 pts. 10,936
  5. Avatar for maithra 45. maithra Lv 1 18 pts. 10,912
  6. Avatar for xythus 46. xythus Lv 1 17 pts. 10,894
  7. Avatar for Anfinsen_slept_here 47. Anfinsen_slept_here Lv 1 17 pts. 10,878
  8. Avatar for equilibria 48. equilibria Lv 1 16 pts. 10,863
  9. Avatar for Combinatoria 49. Combinatoria Lv 1 15 pts. 10,845
  10. Avatar for drumpeter18yrs9yrs 50. drumpeter18yrs9yrs Lv 1 14 pts. 10,844

Comments