Placeholder image of a protein
Icon representing a puzzle

1940: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 06, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,281
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,150
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 10,039
  4. Avatar for Australia 14. Australia 1 pt. 9,961
  5. Avatar for Window Group 15. Window Group 1 pt. 8,548
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,139
  1. Avatar for hansvandenhof 51. hansvandenhof Lv 1 14 pts. 10,841
  2. Avatar for Hanto 52. Hanto Lv 1 13 pts. 10,799
  3. Avatar for fpc 53. fpc Lv 1 12 pts. 10,793
  4. Avatar for Czim 54. Czim Lv 1 12 pts. 10,759
  5. Avatar for zackallen 55. zackallen Lv 1 11 pts. 10,723
  6. Avatar for borattt 56. borattt Lv 1 11 pts. 10,698
  7. Avatar for georg137 57. georg137 Lv 1 10 pts. 10,698
  8. Avatar for ProfVince 58. ProfVince Lv 1 10 pts. 10,677
  9. Avatar for phi16 59. phi16 Lv 1 9 pts. 10,674
  10. Avatar for Todd6485577 60. Todd6485577 Lv 1 9 pts. 10,673

Comments