Placeholder image of a protein
Icon representing a puzzle

1940: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 06, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,281
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,150
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 10,039
  4. Avatar for Australia 14. Australia 1 pt. 9,961
  5. Avatar for Window Group 15. Window Group 1 pt. 8,548
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,139
  1. Avatar for Dhalion 61. Dhalion Lv 1 8 pts. 10,654
  2. Avatar for sciencewalker 62. sciencewalker Lv 1 8 pts. 10,619
  3. Avatar for heather-1 63. heather-1 Lv 1 7 pts. 10,617
  4. Avatar for Pawel Tluscik 64. Pawel Tluscik Lv 1 7 pts. 10,550
  5. Avatar for NeedMoreCoffee 65. NeedMoreCoffee Lv 1 7 pts. 10,545
  6. Avatar for CAN1958 66. CAN1958 Lv 1 6 pts. 10,545
  7. Avatar for argyrw 67. argyrw Lv 1 6 pts. 10,539
  8. Avatar for spdenne 68. spdenne Lv 1 6 pts. 10,534
  9. Avatar for infjamc 69. infjamc Lv 1 5 pts. 10,534
  10. Avatar for zid 70. zid Lv 1 5 pts. 10,530

Comments