Placeholder image of a protein
Icon representing a puzzle

1940: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
January 06, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,281
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,150
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 10,039
  4. Avatar for Australia 14. Australia 1 pt. 9,961
  5. Avatar for Window Group 15. Window Group 1 pt. 8,548
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,139

  1. Avatar for kyoota 71. kyoota Lv 1 5 pts. 10,529
  2. Avatar for Tygh 72. Tygh Lv 1 5 pts. 10,526
  3. Avatar for PeterDav 73. PeterDav Lv 1 4 pts. 10,501
  4. Avatar for kevin everington 74. kevin everington Lv 1 4 pts. 10,495
  5. Avatar for aendgraend 75. aendgraend Lv 1 4 pts. 10,494
  6. Avatar for alcor29 76. alcor29 Lv 1 4 pts. 10,489
  7. Avatar for lraguette 77. lraguette Lv 1 3 pts. 10,487
  8. Avatar for Rustytincan 78. Rustytincan Lv 1 3 pts. 10,481
  9. Avatar for donuts554 79. donuts554 Lv 1 3 pts. 10,470
  10. Avatar for jsfoldingaccount 80. jsfoldingaccount Lv 1 3 pts. 10,468

Comments