Placeholder image of a protein
Icon representing a puzzle

1940: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 06, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,281
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,150
  3. Avatar for Mojo Risin' 13. Mojo Risin' 1 pt. 10,039
  4. Avatar for Australia 14. Australia 1 pt. 9,961
  5. Avatar for Window Group 15. Window Group 1 pt. 8,548
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,139
  1. Avatar for REDing 81. REDing Lv 1 3 pts. 10,464
  2. Avatar for Jakki 82. Jakki Lv 1 3 pts. 10,456
  3. Avatar for WILSON542 83. WILSON542 Lv 1 2 pts. 10,454
  4. Avatar for cjddig 84. cjddig Lv 1 2 pts. 10,433
  5. Avatar for abiogenesis 85. abiogenesis Lv 1 2 pts. 10,417
  6. Avatar for Alistair69 86. Alistair69 Lv 1 2 pts. 10,378
  7. Avatar for rezaefar 87. rezaefar Lv 1 2 pts. 10,378
  8. Avatar for carsonfb 88. carsonfb Lv 1 2 pts. 10,376
  9. Avatar for tracybutt 89. tracybutt Lv 1 2 pts. 10,363
  10. Avatar for Evica 90. Evica Lv 1 2 pts. 10,336

Comments