Placeholder image of a protein
Icon representing a puzzle

1943: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
January 13, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 10,054
  2. Avatar for METU-BIN 12. METU-BIN 1 pt. 9,827
  3. Avatar for Window Group 13. Window Group 1 pt. 8,415
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,370

  1. Avatar for Mohoernchen 91. Mohoernchen Lv 1 1 pt. 10,112
  2. Avatar for rinze 92. rinze Lv 1 1 pt. 10,109
  3. Avatar for Formula350 93. Formula350 Lv 1 1 pt. 10,070
  4. Avatar for AlkiP0Ps 94. AlkiP0Ps Lv 1 1 pt. 10,054
  5. Avatar for Todd6485577 95. Todd6485577 Lv 1 1 pt. 10,003
  6. Avatar for katling 96. katling Lv 1 1 pt. 10,003
  7. Avatar for ivalnic 97. ivalnic Lv 1 1 pt. 9,954
  8. Avatar for Dr.Sillem 98. Dr.Sillem Lv 1 1 pt. 9,950
  9. Avatar for Arne Heessels 99. Arne Heessels Lv 1 1 pt. 9,880
  10. Avatar for LELE1964 100. LELE1964 Lv 1 1 pt. 9,834

Comments


WBarme1234 Lv 1

Puzzle 1943 - Wrong disulfide count -
Usually two(2) disulfide bridges gives 500 points; i'm getting only 250 points -> replacing Puzzle to 1943b?