Placeholder image of a protein
Icon representing a puzzle

1943: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 13, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 10,054
  2. Avatar for METU-BIN 12. METU-BIN 1 pt. 9,827
  3. Avatar for Window Group 13. Window Group 1 pt. 8,415
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,370
  1. Avatar for heyubob 101. heyubob Lv 1 1 pt. 9,833
  2. Avatar for SinemDB 102. SinemDB Lv 1 1 pt. 9,827
  3. Avatar for hajtogato 103. hajtogato Lv 1 1 pt. 9,815
  4. Avatar for ConfusedAlgernon 104. ConfusedAlgernon Lv 1 1 pt. 9,813
  5. Avatar for 2007185 105. 2007185 Lv 1 1 pt. 9,780
  6. Avatar for Kyr4aviu 106. Kyr4aviu Lv 1 1 pt. 9,753
  7. Avatar for MrAcademic 107. MrAcademic Lv 1 1 pt. 9,748
  8. Avatar for IvanBaner 108. IvanBaner Lv 1 1 pt. 9,720
  9. Avatar for drumpeter18yrs9yrs 109. drumpeter18yrs9yrs Lv 1 1 pt. 9,717
  10. Avatar for DasRamoN 110. DasRamoN Lv 1 1 pt. 9,705

Comments

WBarme1234 Lv 1

Puzzle 1943 - Wrong disulfide count -
Usually two(2) disulfide bridges gives 500 points; i'm getting only 250 points -> replacing Puzzle to 1943b?