Placeholder image of a protein
Icon representing a puzzle

1943: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 13, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 10,054
  2. Avatar for METU-BIN 12. METU-BIN 1 pt. 9,827
  3. Avatar for Window Group 13. Window Group 1 pt. 8,415
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,370
  1. Avatar for Yann1ck2000 111. Yann1ck2000 Lv 1 1 pt. 9,698
  2. Avatar for teunlammetje 112. teunlammetje Lv 1 1 pt. 9,687
  3. Avatar for Frosch2002 113. Frosch2002 Lv 1 1 pt. 9,621
  4. Avatar for 9racoon 114. 9racoon Lv 1 1 pt. 9,589
  5. Avatar for illex 115. illex Lv 1 1 pt. 9,509
  6. Avatar for artsycook 116. artsycook Lv 1 1 pt. 9,419
  7. Avatar for zakbumm 117. zakbumm Lv 1 1 pt. 9,037
  8. Avatar for Nur2021 118. Nur2021 Lv 1 1 pt. 9,012
  9. Avatar for Werner1993 119. Werner1993 Lv 1 1 pt. 8,943
  10. Avatar for MrZanav 120. MrZanav Lv 1 1 pt. 8,807

Comments

WBarme1234 Lv 1

Puzzle 1943 - Wrong disulfide count -
Usually two(2) disulfide bridges gives 500 points; i'm getting only 250 points -> replacing Puzzle to 1943b?