Placeholder image of a protein
Icon representing a puzzle

1943: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 13, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 10,054
  2. Avatar for METU-BIN 12. METU-BIN 1 pt. 9,827
  3. Avatar for Window Group 13. Window Group 1 pt. 8,415
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,370
  1. Avatar for American_Lab_D 121. American_Lab_D Lv 1 1 pt. 8,525
  2. Avatar for jflat06 122. jflat06 Lv 1 1 pt. 8,415
  3. Avatar for devjosh 123. devjosh Lv 1 1 pt. 8,370
  4. Avatar for 400190179 124. 400190179 Lv 1 1 pt. 8,370
  5. Avatar for toshiue 125. toshiue Lv 1 1 pt. 8,370
  6. Avatar for bnmoore 126. bnmoore Lv 1 1 pt. 8,370
  7. Avatar for jurep 127. jurep Lv 1 1 pt. 8,370
  8. Avatar for kevin everington 128. kevin everington Lv 1 1 pt. 8,370
  9. Avatar for Bletchley Park 129. Bletchley Park Lv 1 1 pt. 8,370
  10. Avatar for schnghse 130. schnghse Lv 1 1 pt. 8,370

Comments

WBarme1234 Lv 1

Puzzle 1943 - Wrong disulfide count -
Usually two(2) disulfide bridges gives 500 points; i'm getting only 250 points -> replacing Puzzle to 1943b?