Placeholder image of a protein
Icon representing a puzzle

1943: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
January 13, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 10,054
  2. Avatar for METU-BIN 12. METU-BIN 1 pt. 9,827
  3. Avatar for Window Group 13. Window Group 1 pt. 8,415
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,370

  1. Avatar for ucad 41. ucad Lv 1 16 pts. 10,945
  2. Avatar for NeedMoreCoffee 42. NeedMoreCoffee Lv 1 16 pts. 10,935
  3. Avatar for Norrjane 43. Norrjane Lv 1 15 pts. 10,922
  4. Avatar for heather-1 44. heather-1 Lv 1 14 pts. 10,895
  5. Avatar for blazegeek 45. blazegeek Lv 1 13 pts. 10,885
  6. Avatar for Pawel Tluscik 46. Pawel Tluscik Lv 1 12 pts. 10,878
  7. Avatar for Combinatoria 47. Combinatoria Lv 1 12 pts. 10,872
  8. Avatar for NeLikomSheet 48. NeLikomSheet Lv 1 11 pts. 10,868
  9. Avatar for xythus 49. xythus Lv 1 10 pts. 10,862
  10. Avatar for ProfVince 50. ProfVince Lv 1 10 pts. 10,855

Comments


WBarme1234 Lv 1

Puzzle 1943 - Wrong disulfide count -
Usually two(2) disulfide bridges gives 500 points; i'm getting only 250 points -> replacing Puzzle to 1943b?