Placeholder image of a protein
Icon representing a puzzle

1943: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 13, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 10,054
  2. Avatar for METU-BIN 12. METU-BIN 1 pt. 9,827
  3. Avatar for Window Group 13. Window Group 1 pt. 8,415
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,370
  1. Avatar for rezaefar 61. rezaefar Lv 1 5 pts. 10,632
  2. Avatar for REDing 62. REDing Lv 1 5 pts. 10,622
  3. Avatar for Anfinsen_slept_here 63. Anfinsen_slept_here Lv 1 4 pts. 10,621
  4. Avatar for hada 64. hada Lv 1 4 pts. 10,595
  5. Avatar for sciencewalker 65. sciencewalker Lv 1 4 pts. 10,591
  6. Avatar for wosser1 66. wosser1 Lv 1 4 pts. 10,585
  7. Avatar for Evica 67. Evica Lv 1 3 pts. 10,581
  8. Avatar for tracybutt 68. tracybutt Lv 1 3 pts. 10,572
  9. Avatar for BarrySampson 69. BarrySampson Lv 1 3 pts. 10,569
  10. Avatar for Jumper2 70. Jumper2 Lv 1 3 pts. 10,542

Comments

WBarme1234 Lv 1

Puzzle 1943 - Wrong disulfide count -
Usually two(2) disulfide bridges gives 500 points; i'm getting only 250 points -> replacing Puzzle to 1943b?