Placeholder image of a protein
Icon representing a puzzle

1946: Revisiting Puzzle 52: Bacteria Energy

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 20, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 2 pts. 10,533
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,269
  3. Avatar for Australia 13. Australia 1 pt. 10,133
  4. Avatar for Korean 14. Korean 1 pt. 9,785
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,130
  6. Avatar for Deleted group 16. Deleted group pts. 8,801
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 0
  8. Avatar for Window Group 18. Window Group 1 pt. 0
  1. Avatar for Dr.Sillem 101. Dr.Sillem Lv 1 1 pt. 10,108
  2. Avatar for andrewxc 102. andrewxc Lv 1 1 pt. 10,102
  3. Avatar for Beany 103. Beany Lv 1 1 pt. 10,101
  4. Avatar for fuoco 104. fuoco Lv 1 1 pt. 10,094
  5. Avatar for drjr 105. drjr Lv 1 1 pt. 10,062
  6. Avatar for Mohoernchen 106. Mohoernchen Lv 1 1 pt. 10,056
  7. Avatar for Arne Heessels 107. Arne Heessels Lv 1 1 pt. 10,047
  8. Avatar for agnairt 108. agnairt Lv 1 1 pt. 10,004
  9. Avatar for Todd6485577 109. Todd6485577 Lv 1 1 pt. 10,003
  10. Avatar for rinze 110. rinze Lv 1 1 pt. 9,987

Comments