Placeholder image of a protein
Icon representing a puzzle

1946: Revisiting Puzzle 52: Bacteria Energy

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 20, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 2 pts. 10,533
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,269
  3. Avatar for Australia 13. Australia 1 pt. 10,133
  4. Avatar for Korean 14. Korean 1 pt. 9,785
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,130
  6. Avatar for Deleted group 16. Deleted group pts. 8,801
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 0
  8. Avatar for Window Group 18. Window Group 1 pt. 0
  1. Avatar for Danilino98 131. Danilino98 Lv 1 1 pt. 8,782
  2. Avatar for Waukeeblobel 132. Waukeeblobel Lv 1 1 pt. 1,285
  3. Avatar for nahunhee 133. nahunhee Lv 1 1 pt. 0
  4. Avatar for toshiue 134. toshiue Lv 1 1 pt. 0
  5. Avatar for Bletchley Park 135. Bletchley Park Lv 1 1 pt. 0
  6. Avatar for osnazgry 136. osnazgry Lv 1 1 pt. 0
  7. Avatar for RockOn 137. RockOn Lv 1 1 pt. 0
  8. Avatar for jgreene305 138. jgreene305 Lv 1 1 pt. 0
  9. Avatar for devjosh 139. devjosh Lv 1 1 pt. 0
  10. Avatar for jflat06 140. jflat06 Lv 1 1 pt. 0

Comments