Placeholder image of a protein
Icon representing a puzzle

1946: Revisiting Puzzle 52: Bacteria Energy

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 20, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 2 pts. 10,533
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,269
  3. Avatar for Australia 13. Australia 1 pt. 10,133
  4. Avatar for Korean 14. Korean 1 pt. 9,785
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,130
  6. Avatar for Deleted group 16. Deleted group pts. 8,801
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 0
  8. Avatar for Window Group 18. Window Group 1 pt. 0
  1. Avatar for nicobul 21. nicobul Lv 1 46 pts. 11,085
  2. Avatar for Deleted player 22. Deleted player 45 pts. 11,080
  3. Avatar for NinjaGreg 23. NinjaGreg Lv 1 43 pts. 11,076
  4. Avatar for akaaka 24. akaaka Lv 1 41 pts. 11,064
  5. Avatar for PieThrower 25. PieThrower Lv 1 39 pts. 11,056
  6. Avatar for Galaxie 26. Galaxie Lv 1 38 pts. 11,043
  7. Avatar for WBarme1234 27. WBarme1234 Lv 1 36 pts. 11,042
  8. Avatar for NeLikomSheet 28. NeLikomSheet Lv 1 34 pts. 11,030
  9. Avatar for Phyx 29. Phyx Lv 1 33 pts. 11,023
  10. Avatar for guineapig 30. guineapig Lv 1 32 pts. 11,018

Comments