Placeholder image of a protein
Icon representing a puzzle

1946: Revisiting Puzzle 52: Bacteria Energy

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 20, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 2 pts. 10,533
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,269
  3. Avatar for Australia 13. Australia 1 pt. 10,133
  4. Avatar for Korean 14. Korean 1 pt. 9,785
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,130
  6. Avatar for Deleted group 16. Deleted group pts. 8,801
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 0
  8. Avatar for Window Group 18. Window Group 1 pt. 0
  1. Avatar for rezaefar 61. rezaefar Lv 1 6 pts. 10,616
  2. Avatar for hada 62. hada Lv 1 6 pts. 10,608
  3. Avatar for sciencewalker 63. sciencewalker Lv 1 6 pts. 10,601
  4. Avatar for ShadowTactics 64. ShadowTactics Lv 1 5 pts. 10,600
  5. Avatar for ucad 65. ucad Lv 1 5 pts. 10,592
  6. Avatar for maithra 66. maithra Lv 1 5 pts. 10,590
  7. Avatar for Vinara 67. Vinara Lv 1 4 pts. 10,584
  8. Avatar for phi16 68. phi16 Lv 1 4 pts. 10,557
  9. Avatar for Dhalion 69. Dhalion Lv 1 4 pts. 10,553
  10. Avatar for drumpeter18yrs9yrs 70. drumpeter18yrs9yrs Lv 1 4 pts. 10,544

Comments