Placeholder image of a protein
Icon representing a puzzle

1946: Revisiting Puzzle 52: Bacteria Energy

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 20, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 2 pts. 10,533
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,269
  3. Avatar for Australia 13. Australia 1 pt. 10,133
  4. Avatar for Korean 14. Korean 1 pt. 9,785
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,130
  6. Avatar for Deleted group 16. Deleted group pts. 8,801
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 0
  8. Avatar for Window Group 18. Window Group 1 pt. 0
  1. Avatar for wosser1 81. wosser1 Lv 1 2 pts. 10,421
  2. Avatar for borattt 82. borattt Lv 1 2 pts. 10,399
  3. Avatar for heather-1 83. heather-1 Lv 1 2 pts. 10,397
  4. Avatar for blazegeek 84. blazegeek Lv 1 2 pts. 10,388
  5. Avatar for Trajan464 85. Trajan464 Lv 1 1 pt. 10,363
  6. Avatar for Donobit 86. Donobit Lv 1 1 pt. 10,356
  7. Avatar for NPrincipi 87. NPrincipi Lv 1 1 pt. 10,355
  8. Avatar for Rustytincan 88. Rustytincan Lv 1 1 pt. 10,312
  9. Avatar for kevin everington 89. kevin everington Lv 1 1 pt. 10,312
  10. Avatar for CAN1958 90. CAN1958 Lv 1 1 pt. 10,305

Comments