Placeholder image of a protein
Icon representing a puzzle

1955: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
February 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Olsztynek 11. Olsztynek 1 pt. 9,025
  2. Avatar for Australia 12. Australia 1 pt. 9,007
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,972
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,913
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,697
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 7,366
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 5,479
  1. Avatar for aendgraend 91. aendgraend Lv 1 1 pt. 8,913
  2. Avatar for Arne Heessels 92. Arne Heessels Lv 1 1 pt. 8,903
  3. Avatar for Evica 93. Evica Lv 1 1 pt. 8,900
  4. Avatar for fishercat 94. fishercat Lv 1 1 pt. 8,889
  5. Avatar for zannipietro 95. zannipietro Lv 1 1 pt. 8,841
  6. Avatar for drjr 96. drjr Lv 1 1 pt. 8,812
  7. Avatar for kevin everington 97. kevin everington Lv 1 1 pt. 8,763
  8. Avatar for Mohoernchen 98. Mohoernchen Lv 1 1 pt. 8,723
  9. Avatar for vuvuvu 99. vuvuvu Lv 1 1 pt. 8,697
  10. Avatar for FishKAA 100. FishKAA Lv 1 1 pt. 8,691

Comments