Placeholder image of a protein
Icon representing a puzzle

1955: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
February 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Olsztynek 11. Olsztynek 1 pt. 9,025
  2. Avatar for Australia 12. Australia 1 pt. 9,007
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,972
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,913
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,697
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 7,366
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 5,479
  1. Avatar for nspc 101. nspc Lv 1 1 pt. 8,642
  2. Avatar for tracybutt 102. tracybutt Lv 1 1 pt. 8,634
  3. Avatar for sciencewalker 103. sciencewalker Lv 1 1 pt. 8,592
  4. Avatar for philcalhoun 104. philcalhoun Lv 1 1 pt. 8,577
  5. Avatar for GuR0 105. GuR0 Lv 1 1 pt. 8,512
  6. Avatar for pascal ochem 106. pascal ochem Lv 1 1 pt. 8,503
  7. Avatar for NPrincipi 107. NPrincipi Lv 1 1 pt. 8,408
  8. Avatar for reich64 108. reich64 Lv 1 1 pt. 8,383
  9. Avatar for multaq 109. multaq Lv 1 1 pt. 8,371
  10. Avatar for rabamino12358 110. rabamino12358 Lv 1 1 pt. 8,346

Comments