Placeholder image of a protein
Icon representing a puzzle

1955: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
February 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Olsztynek 11. Olsztynek 1 pt. 9,025
  2. Avatar for Australia 12. Australia 1 pt. 9,007
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,972
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,913
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,697
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 7,366
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 5,479
  1. Avatar for Sydefecks 121. Sydefecks Lv 1 1 pt. 7,586
  2. Avatar for Seigo 122. Seigo Lv 1 1 pt. 7,522
  3. Avatar for HMK 123. HMK Lv 1 1 pt. 7,507
  4. Avatar for AnyaWarrior 124. AnyaWarrior Lv 1 1 pt. 7,495
  5. Avatar for haggisfam 125. haggisfam Lv 1 1 pt. 7,446
  6. Avatar for Altercomp 126. Altercomp Lv 1 1 pt. 7,427
  7. Avatar for morlando89 127. morlando89 Lv 1 1 pt. 7,366
  8. Avatar for Dr-27 128. Dr-27 Lv 1 1 pt. 7,316
  9. Avatar for Sammy3c2b1a0 129. Sammy3c2b1a0 Lv 1 1 pt. 7,295
  10. Avatar for frostschutz 130. frostschutz Lv 1 1 pt. 7,216

Comments