Placeholder image of a protein
Icon representing a puzzle

1955: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
February 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Olsztynek 11. Olsztynek 1 pt. 9,025
  2. Avatar for Australia 12. Australia 1 pt. 9,007
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,972
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,913
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,697
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 7,366
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 5,479

  1. Avatar for Swapper242 131. Swapper242 Lv 1 1 pt. 6,897
  2. Avatar for ivalnic 132. ivalnic Lv 1 1 pt. 6,768
  3. Avatar for 190051989 133. 190051989 Lv 1 1 pt. 6,555
  4. Avatar for JSon 134. JSon Lv 1 1 pt. 6,399
  5. Avatar for daseong 135. daseong Lv 1 1 pt. 6,308
  6. Avatar for Carbon123 136. Carbon123 Lv 1 1 pt. 6,102
  7. Avatar for xayam 137. xayam Lv 1 1 pt. 6,085
  8. Avatar for antproteo 138. antproteo Lv 1 1 pt. 6,076
  9. Avatar for SoleneTOUSSAINT55 139. SoleneTOUSSAINT55 Lv 1 1 pt. 5,888
  10. Avatar for devjosh 140. devjosh Lv 1 1 pt. 5,479

Comments