Placeholder image of a protein
Icon representing a puzzle

1955: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 5 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Olsztynek 11. Olsztynek 1 pt. 9,025
  2. Avatar for Australia 12. Australia 1 pt. 9,007
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,972
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,913
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,697
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 7,366
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 5,479

  1. Avatar for Aubade01 11. Aubade01 Lv 1 71 pts. 10,475
  2. Avatar for guineapig 12. guineapig Lv 1 68 pts. 10,461
  3. Avatar for PieThrower 13. PieThrower Lv 1 66 pts. 10,430
  4. Avatar for georg137 14. georg137 Lv 1 63 pts. 10,391
  5. Avatar for Bruno Kestemont 15. Bruno Kestemont Lv 1 61 pts. 10,385
  6. Avatar for silent gene 16. silent gene Lv 1 59 pts. 10,381
  7. Avatar for Phyx 17. Phyx Lv 1 57 pts. 10,378
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 55 pts. 10,349
  9. Avatar for Enzyme 19. Enzyme Lv 1 53 pts. 10,343
  10. Avatar for MicElephant 20. MicElephant Lv 1 51 pts. 10,311

Comments