Placeholder image of a protein
Icon representing a puzzle

1955: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
February 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Olsztynek 11. Olsztynek 1 pt. 9,025
  2. Avatar for Australia 12. Australia 1 pt. 9,007
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,972
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,913
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,697
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 7,366
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 5,479

  1. Avatar for robgee 21. robgee Lv 1 49 pts. 10,304
  2. Avatar for ichwilldiesennamen 22. ichwilldiesennamen Lv 1 47 pts. 10,292
  3. Avatar for aznarog 23. aznarog Lv 1 45 pts. 10,289
  4. Avatar for jobo0502 24. jobo0502 Lv 1 43 pts. 10,281
  5. Avatar for Lotus23 25. Lotus23 Lv 1 42 pts. 10,255
  6. Avatar for Galaxie 26. Galaxie Lv 1 40 pts. 10,245
  7. Avatar for pauldunn 27. pauldunn Lv 1 38 pts. 10,240
  8. Avatar for johnmitch 28. johnmitch Lv 1 37 pts. 10,239
  9. Avatar for NeLikomSheet 29. NeLikomSheet Lv 1 35 pts. 10,229
  10. Avatar for dcrwheeler 30. dcrwheeler Lv 1 34 pts. 10,212

Comments