Placeholder image of a protein
Icon representing a puzzle

1955: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
February 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Olsztynek 11. Olsztynek 1 pt. 9,025
  2. Avatar for Australia 12. Australia 1 pt. 9,007
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,972
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,913
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,697
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 7,366
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 5,479

  1. Avatar for WBarme1234 31. WBarme1234 Lv 1 32 pts. 10,202
  2. Avatar for BootsMcGraw 32. BootsMcGraw Lv 1 31 pts. 10,186
  3. Avatar for xythus 33. xythus Lv 1 30 pts. 10,185
  4. Avatar for g_b 34. g_b Lv 1 29 pts. 10,185
  5. Avatar for infjamc 35. infjamc Lv 1 27 pts. 10,174
  6. Avatar for jausmh 36. jausmh Lv 1 26 pts. 10,166
  7. Avatar for Formula350 37. Formula350 Lv 1 25 pts. 10,149
  8. Avatar for akaaka 38. akaaka Lv 1 24 pts. 10,123
  9. Avatar for Vinara 39. Vinara Lv 1 23 pts. 10,069
  10. Avatar for Norrjane 40. Norrjane Lv 1 22 pts. 10,064

Comments