Placeholder image of a protein
Icon representing a puzzle

1955: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
February 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Olsztynek 11. Olsztynek 1 pt. 9,025
  2. Avatar for Australia 12. Australia 1 pt. 9,007
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,972
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,913
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,697
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 7,366
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 5,479
  1. Avatar for Blipperman 41. Blipperman Lv 1 21 pts. 10,006
  2. Avatar for equilibria 42. equilibria Lv 1 20 pts. 9,984
  3. Avatar for Deleted player 43. Deleted player pts. 9,965
  4. Avatar for Anfinsen_slept_here 44. Anfinsen_slept_here Lv 1 18 pts. 9,952
  5. Avatar for nicobul 45. nicobul Lv 1 17 pts. 9,908
  6. Avatar for Deleted player 46. Deleted player 17 pts. 9,878
  7. Avatar for OWM3 47. OWM3 Lv 1 16 pts. 9,873
  8. Avatar for Hellcat6 48. Hellcat6 Lv 1 15 pts. 9,817
  9. Avatar for j.wohlmann 49. j.wohlmann Lv 1 14 pts. 9,806
  10. Avatar for bx7gn 50. bx7gn Lv 1 14 pts. 9,791

Comments