Placeholder image of a protein
Icon representing a puzzle

1955: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
February 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Olsztynek 11. Olsztynek 1 pt. 9,025
  2. Avatar for Australia 12. Australia 1 pt. 9,007
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,972
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,913
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,697
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 7,366
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 5,479
  1. Avatar for cjddig 61. cjddig Lv 1 8 pts. 9,561
  2. Avatar for donuts554 62. donuts554 Lv 1 7 pts. 9,548
  3. Avatar for prooh 63. prooh Lv 1 7 pts. 9,523
  4. Avatar for jsfoldingaccount 64. jsfoldingaccount Lv 1 7 pts. 9,521
  5. Avatar for Vincera 65. Vincera Lv 1 6 pts. 9,454
  6. Avatar for BarrySampson 66. BarrySampson Lv 1 6 pts. 9,434
  7. Avatar for drumpeter18yrs9yrs 67. drumpeter18yrs9yrs Lv 1 6 pts. 9,332
  8. Avatar for PeterDav 68. PeterDav Lv 1 5 pts. 9,301
  9. Avatar for hansvandenhof 69. hansvandenhof Lv 1 5 pts. 9,293
  10. Avatar for ShadowTactics 70. ShadowTactics Lv 1 5 pts. 9,269

Comments